Structure of PDB 6n8o Chain E

Receptor sequence

>6n8oE (length=384) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKA
GMTTIVRDLDRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRS
LTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARI
KKYASVVRVLVHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEK
TVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVAC
IGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRT
KKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKAL
EEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKK

3D structure

PDB

6n8o Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	S2 H3 Y6 E7 A8 P9 R10 H11 G12 H13 L14 G15 F16 P18 R19 K20 R21 R26 R28 K30 A31 M53 T55 R62 G64 S65 A75 Y92 T95 R97 L99 R100 S101 L102 T104 W106 R117 F118 Y119 K120 N121 Y123 K124 K126 K128 F130 K132 Y133 R150 Y154 Q173 K174 E180 T221 K222 G223 H224 G225 F226 G228 H231 R232 K236 R240 K241 T242 H243 R244 G245 R247 K248 A250 C251 I252 G253 A254 W255 H256 P257 A258 H259 V260 S263 R266 Q269 S274 T276 I278 N279 H313 G315 K325 C327 P329 G330 R332 K333 R334 Y343 R348 K349 S363 K364 F365 G366 K376 M380 K384	S1 H2 Y5 E6 A7 P8 R9 H10 G11 H12 L13 G14 F15 P17 R18 K19 R20 R25 R27 K29 A30 M52 T54 R61 G63 S64 A74 Y91 T94 R96 L98 R99 S100 L101 T103 W105 R116 F117 Y118 K119 N120 Y122 K123 K125 K127 F129 K131 Y132 R149 Y153 Q172 K173 E179 T220 K221 G222 H223 G224 F225 G227 H230 R231 K235 R239 K240 T241 H242 R243 G244 R246 K247 A249 C250 I251 G252 A253 W254 H255 P256 A257 H258 V259 S262 R265 Q268 S273 T275 I277 N278 H312 G314 K324 C326 P328 G329 R331 K332 R333 Y342 R347 K348 S362 K363 F364 G365 K375 M379 K383

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0006414	translational elongation
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6n8o, PDBe:6n8o, PDBj:6n8o
PDBsum	6n8o
PubMed	30814529
UniProt	P14126\|RL3_YEAST Large ribosomal subunit protein uL3 (Gene Name=RPL3)

[Back to BioLiP]