Structure of PDB 6n7i Chain E

Receptor sequence

>6n7iE (length=241) Species: 10760 (Escherichia phage T7)

VGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMG
KKVGLAMLQESVEETAEDLIGLHNRVRLRQSDSLKREIIKFDQWFDELFG
NDTFHLYDRLLAKLAYMRSGLGCDVIILDHISIVRKMIDNLMTKLKGFAK
STGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALER
NQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPS

3D structure

• PDB: 6n7i Structures and operating principles of the replisome.
• Chain: E
• Resolution: 3.2 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.-
  3.6.4.12: DNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	E	R439 N468 L486 G490	R135 N164 L182 G186
BS02	TTP	E	S314 G315 G317 K318 S319 T320 Q343 R504 N512 Y535	S30 G31 G33 K34 S35 T36 Q59 R200 N208 Y231
BS03	MG	E	S319 Q343	S35 Q59

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003678 DNA helicase activity
• GO:0003697 single-stranded DNA binding
• GO:0003896 DNA primase activity
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0008270 zinc ion binding
• GO:0016779 nucleotidyltransferase activity
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding
• GO:0043139 5'-3' DNA helicase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006269 DNA replication, synthesis of primer
• GO:0032508 DNA duplex unwinding
• GO:0039693 viral DNA genome replication

Cellular Component

• GO:1990077 primosome complex

External links

• PDB: RCSB:6n7i, PDBe:6n7i, PDBj:6n7i
• PDBsum: 6n7i
• PubMed: 30679383
• UniProt: P03692|HELIC_BPT7 DNA helicase/primase (Gene Name=4)