Structure of PDB 6lxt Chain E |
>6lxtE (length=114) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence] |
VLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVK QLSSNFGAISSVLNDILSRLDKVEDVDLGDISGINASVVNIQKEIDRLNE VAKNLNESLIDLQE |
|
PDB | 6lxt Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. |
Chain | E |
Resolution | 2.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
E |
D1163 D1165 |
D75 D77 |
|
|
|
|