Structure of PDB 6jm9 Chain E

Receptor sequence
>6jm9E (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB6jm9 Structural basis of recognition and destabilization of the histone H2B ubiquitinated nucleosome by the DOT1L histone H3 Lys79 methyltransferase.
ChainE
Resolution7.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R40 Y41 P43 G44 V46 A47 R63 K64 L65 P66 R69 R83 R3 Y4 P6 G7 V9 A10 R26 K27 L28 P29 R32 R46
BS02 dna E R42 P43 R63 R72 R83 F84 Q85 S86 R116 V117 T118 R5 P6 R26 R35 R46 F47 Q48 S49 R79 V80 T81
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6jm9, PDBe:6jm9, PDBj:6jm9
PDBsum6jm9
PubMed30923167
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]