Structure of PDB 6iy3 Chain E

Receptor sequence
>6iy3E (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB6iy3 Mechanism of DNA translocation underlying chromatin remodelling by Snf2.
ChainE
Resolution3.67 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H39 R40 Y41 G44 V46 R49 K56 R63 L65 P66 R69 R83 H3 R4 Y5 G8 V10 R13 K20 R27 L29 P30 R33 R47
BS02 dna E K37 Y41 R42 T45 R83 F84 R116 V117 K1 Y5 R6 T9 R47 F48 R80 V81
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6iy3, PDBe:6iy3, PDBj:6iy3
PDBsum6iy3
PubMed30867599
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]