Structure of PDB 6ifc Chain E

Receptor sequence
>6ifcE (length=132) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKS
LAPERNLAVVEGFISRLEVLDYDTQAAIHTGQIRAELARKGTPVGPYDQM
IAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
3D structure
PDB6ifc Crystal structure of proteolyzed VapBC and DNA-bound VapBC from Salmonella enterica Typhimurium LT2 and VapC as a putative Ca2+-dependent ribonuclease.
ChainE
Resolution1.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide E T8 I12 I15 K16 K18 R23 F26 N27 E42 G46 A47 S50 L51 R55 N56 V59 G62 F63 R66 G95 Y97 D98 T8 I12 I15 K16 K18 R23 F26 N27 E42 G46 A47 S50 L51 R55 N56 V59 G62 F63 R66 G95 Y97 D98
BS02 CA E D7 T8 N9 D7 T8 N9
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004519 endonuclease activity
GO:0004540 RNA nuclease activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6ifc, PDBe:6ifc, PDBj:6ifc
PDBsum6ifc
PubMed31908032
UniProtQ8ZM86|VAPC_SALTY tRNA(fMet)-specific endonuclease VapC (Gene Name=vapC)

[Back to BioLiP]