Structure of PDB 6gsm Chain E

Receptor sequence

>6gsmE (length=260) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

ARGPKKHLKRLAAPHHWMLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNR
LKYALNGREVKAILMQRHVKVDGKVRTDTTFPAGFMDVITLEATNENFRL
VYDVKGRFAVHRITDEEASYKLAKVKKVQLGKKGIPYVVTHDGRTIRYPD
PNIKVNDTVKVDLATGTITDFIKFDTGKLVYVTGGRNLGRVGTIVHRERH
EGGFDLVHIKDSLENTFVTRLNNVFVIGEPGRPWISLPKGKGIKLTISEE
RDRRRAQHGL

3D structure

• PDB: 6gsm Large-scale movement of eIF3 domains during translation initiation modulate start codon selection.
• Chain: E
• Resolution: 5.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	A2 R3 G4 P5 K6 K7 H8 K10 R11 L12 H16 M19 K22 L23 C26 Y27 A28 P29 R30 A33 G34 H36 K37 L38 R49 R51 N57 R59 K62 M66 K75 T81 K106 R108 Q130 L131 G132 K133 K134 G135 Y138 R145 T146 R148 K155 G186 R187 H197 H201 I248 R255 L261	A1 R2 G3 P4 K5 K6 H7 K9 R10 L11 H15 M18 K21 L22 C25 Y26 A27 P28 R29 A32 G33 H35 K36 L37 R48 R50 N56 R58 K61 M65 K74 T80 K105 R107 Q129 L130 G131 K132 K133 G134 Y137 R144 T145 R147 K154 G185 R186 H196 H200 I247 R254 L260

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gsm, PDBe:6gsm, PDBj:6gsm
• PDBsum: 6gsm
• PubMed: 34648019
• UniProt: Q6CWJ2