Structure of PDB 6dzt Chain E

Receptor sequence
>6dztE (length=96) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
3D structure
PDB6dzt Atomic resolution cryo-EM structure of a native-like CENP-A nucleosome aided by an antibody fragment.
ChainE
Resolution2.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H39 R40 Y41 P43 V46 R49 R63 K64 L65 P66 R69 H2 R3 Y4 P6 V9 R12 R26 K27 L28 P29 R32
BS02 dna E R42 T45 R72 R83 F84 Q85 V117 T118 R5 T8 R35 R46 F47 Q48 V80 T81
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0035059 RCAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dzt, PDBe:6dzt, PDBj:6dzt
PDBsum6dzt
PubMed31127102
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]