Structure of PDB 6dyk Chain E

Receptor sequence

>6dykE (length=106) Species: 562 (Escherichia coli)

ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLED
KSPDSPEMWDFRHGFDHLVYHIDDALKLANEGKVKEAQAAAEQLKCHRNA
AIQKYL

3D structure

• PDB: 6dyk An efficient, step-economical strategy for the design of functional metalloproteins.
• Chain: E
• Resolution: 1.955 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	E	H67 H71 H97	H67 H71 H97
BS02	NO	E	H67 H71	H67 H71

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:6dyk, PDBe:6dyk, PDBj:6dyk
• PDBsum: 6dyk
• PubMed: 30778140
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)