Structure of PDB 6bcy Chain E

Receptor sequence

>6bcyE (length=230) Species: 9606 (Homo sapiens)

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKN
VVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL
LDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQ
EAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAI
AELDTLNEDSYKDSTLIMQLLRDNLTLWTS

3D structure

• PDB: 6bcy Mechanism of IRSp53 inhibition by 14-3-3.
• Chain: E
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	S45 K49 N50 R56 R127 Y128 L172 N173 V176 L220 D223 N224 L227 W228	S45 K49 N50 R56 R127 Y128 L172 N173 V176 L220 D223 N224 L227 W228

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0019904 protein domain specific binding
• GO:0042802 identical protein binding
• GO:0044325 transmembrane transporter binding
• GO:0071889 14-3-3 protein binding

Biological Process

• GO:0006605 protein targeting
• GO:0007165 signal transduction
• GO:0007264 small GTPase-mediated signal transduction
• GO:0008104 protein localization
• GO:0021762 substantia nigra development
• GO:0034766 negative regulation of monoatomic ion transmembrane transport
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0045202 synapse
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:6bcy, PDBe:6bcy, PDBj:6bcy
• PDBsum: 6bcy
• PubMed: 30696821
• UniProt: P27348|1433T_HUMAN 14-3-3 protein theta (Gene Name=YWHAQ)