Structure of PDB 6ahu Chain E

Receptor sequence

>6ahuE (length=147) Species: 9606 (Homo sapiens)

VRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSI
GFAVRYLNAYTGIVLLRCRKEFYQLVWSALPFITYLENKGHRYPCFFNTL
HVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQKSVTRSCLL

3D structure

• PDB: 6ahu Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
• Chain: E
• Resolution: 3.66 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.5: ribonuclease P.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	R3 K5 R7 Y8 R56 K71 G104 T106 R108	R2 K4 R6 Y7 R55 K70 G103 T105 R107

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004526 ribonuclease P activity
• GO:0005515 protein binding
• GO:0033204 ribonuclease P RNA binding

Biological Process

• GO:0001682 tRNA 5'-leader removal
• GO:0006364 rRNA processing
• GO:0008033 tRNA processing

Cellular Component

• GO:0000172 ribonuclease MRP complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005655 nucleolar ribonuclease P complex
• GO:0005730 nucleolus
• GO:0030677 ribonuclease P complex
• GO:0030681 multimeric ribonuclease P complex
• GO:1902555 endoribonuclease complex
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ahu, PDBe:6ahu, PDBj:6ahu
• PDBsum: 6ahu
• PubMed: 30454648
• UniProt: Q969H6|POP5_HUMAN Ribonuclease P/MRP protein subunit POP5 (Gene Name=POP5)