Structure of PDB 6ah3 Chain E

Receptor sequence

>6ah3E (length=146) Species: 559292 (Saccharomyces cerevisiae S288C)

VRLKSRYILFEIIFPPTDTNVEESVSKADILLSHHRASPADVSIKSILQE
IRRSLSLNLGDYGSAKCNSLLQLKYFSNKTSTGIIRCHREDCDLVIMALM
LMSKIGDVDGLIVNPVKVSGTIKKIEQFAMRRNSKILNIIKCSQSS

3D structure

• PDB: 6ah3 Structural insight into precursor tRNA processing by yeast ribonuclease P.
• Chain: E
• Resolution: 3.48 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.5: ribonuclease P.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	R3 K5 Y8 K118 V119 S120 G121 T122 I123 K124 K125 F129 R132 I140	R2 K4 Y7 K117 V118 S119 G120 T121 I122 K123 K124 F128 R131 I139
BS02	rna	E	V2 L4 L71	V1 L3 L70

Gene Ontology

Molecular Function

• GO:0000171 ribonuclease MRP activity
• GO:0003723 RNA binding
• GO:0004526 ribonuclease P activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity
• GO:0033204 ribonuclease P RNA binding

Biological Process

• GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
• GO:0000460 maturation of 5.8S rRNA
• GO:0001682 tRNA 5'-leader removal
• GO:0006364 rRNA processing
• GO:0008033 tRNA processing
• GO:0034965 intronic box C/D snoRNA processing

Cellular Component

• GO:0000172 ribonuclease MRP complex
• GO:0005634 nucleus
• GO:0005655 nucleolar ribonuclease P complex
• GO:0005737 cytoplasm
• GO:0030677 ribonuclease P complex
• GO:1902555 endoribonuclease complex
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ah3, PDBe:6ah3, PDBj:6ah3
• PDBsum: 6ah3
• PubMed: 30262633
• UniProt: P28005|POP5_YEAST Ribonuclease P/MRP protein subunit POP5 (Gene Name=POP5)