Structure of PDB 6agb Chain E

Receptor sequence
>6agbE (length=146) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
VRLKSRYILFEIIFPPTDTNVEESVSKADILLSHHRASPADVSIKSILQE
IRRSLSLNLGDYGSAKCNSLLQLKYFSNKTSTGIIRCHREDCDLVIMALM
LMSKIGDVDGLIVNPVKVSGTIKKIEQFAMRRNSKILNIIKCSQSS
3D structure
PDB6agb Structural insight into precursor tRNA processing by yeast ribonuclease P.
ChainE
Resolution3.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.26.5: ribonuclease P.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna E V2 R3 K5 R7 Y8 K28 K118 V119 S120 T122 I123 K124 K125 F129 R132 V1 R2 K4 R6 Y7 K27 K117 V118 S119 T121 I122 K123 K124 F128 R131
Gene Ontology
Molecular Function
GO:0000171 ribonuclease MRP activity
GO:0003723 RNA binding
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0033204 ribonuclease P RNA binding
Biological Process
GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
GO:0000460 maturation of 5.8S rRNA
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0008033 tRNA processing
GO:0034965 intronic box C/D snoRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005655 nucleolar ribonuclease P complex
GO:0005737 cytoplasm
GO:0030677 ribonuclease P complex
GO:1902555 endoribonuclease complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6agb, PDBe:6agb, PDBj:6agb
PDBsum6agb
PubMed30262633
UniProtP28005|POP5_YEAST Ribonuclease P/MRP protein subunit POP5 (Gene Name=POP5)

[Back to BioLiP]