Structure of PDB 5zjt Chain E

Receptor sequence
>5zjtE (length=58) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
KKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNR
RMKNKKNS
3D structure
PDB5zjt Intrinsic DNA Shape Accounts for Affinity Differences between Hox-Cofactor Binding Sites.
ChainE
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E L32 K36 L12 K16
BS02 dna E R23 Y43 R49 Q68 R71 M72 K75 R3 Y23 R29 Q48 R51 M52 K55
BS03 dna E R23 K24 P25 Y26 R61 Q62 I65 N69 K73 R3 K4 P5 Y6 R41 Q42 I45 N49 K53
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5zjt, PDBe:5zjt, PDBj:5zjt
PDBsum5zjt
PubMed30157419
UniProtP09087|ABDB_DROME Homeobox protein abdominal-B (Gene Name=Abd-B)

[Back to BioLiP]