Structure of PDB 5z3l Chain E

Receptor sequence
>5z3lE (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB5z3l Mechanism of DNA translocation underlying chromatin remodelling by Snf2.
ChainE
Resolution4.31 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R40 Y41 R42 P43 T45 R63 R72 R83 F84 Q85 R116 T118 R1 Y2 R3 P4 T6 R24 R33 R44 F45 Q46 R77 T79
BS02 dna E Y41 R63 K64 L65 P66 R69 Y2 R24 K25 L26 P27 R30
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5z3l, PDBe:5z3l, PDBj:5z3l
PDBsum5z3l
PubMed30867599
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]