Structure of PDB 5ypw Chain E

Receptor sequence
>5ypwE (length=90) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence]
DNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLV
NDDQRLEQMISQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ
3D structure
PDB5ypw Crystallographic Structures of IlvN·Val/Ile Complexes: Conformational Selectivity for Feedback Inhibition of Aceto Hydroxy Acid Synthases.
ChainE
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.2.1.6: acetolactate synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 VAL E H20 M24 C43 H12 M16 C35
BS02 VAL E N37 V38 N29 V30
Gene Ontology
Molecular Function
GO:0003984 acetolactate synthase activity
GO:0005515 protein binding
GO:0016740 transferase activity
GO:1990610 acetolactate synthase regulator activity
Biological Process
GO:0008652 amino acid biosynthetic process
GO:0009082 branched-chain amino acid biosynthetic process
GO:0009097 isoleucine biosynthetic process
GO:0009099 L-valine biosynthetic process
Cellular Component
GO:0005829 cytosol
GO:0005948 acetolactate synthase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ypw, PDBe:5ypw, PDBj:5ypw
PDBsum5ypw
PubMed30887800
UniProtP0ADF8|ILVN_ECOLI Acetolactate synthase isozyme 1 small subunit (Gene Name=ilvN)

[Back to BioLiP]