Structure of PDB 5xvp Chain E

Receptor sequence
>5xvpE (length=104) Species: 749498 (Enterococcus faecalis TX0027) [Search protein sequence]
RYMRLLLMFDMPTDTASDRKAYRKFRKFLINEGFIMHQFSVYSKILLNDT
ANKAMLARLKQNNPQRGLITLLNVTEKQFSRMIYLHGEQDNRVANSDERI
VFLG
3D structure
PDB5xvp How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.
ChainE
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E K23 R26 D52 T78 K80 K20 R23 D49 T75 K77
BS02 dna E R4 F12 D13 M14 T16 D17 Y25 R29 S43 Y45 N51 R1 F9 D10 M11 T13 D14 Y22 R26 S40 Y42 N48
BS03 MG E F12 D13 S43 F9 D10 S40
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 07:51:38 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5xvp', asym_id = 'E', title = 'How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5xvp', asym_id='E', title='How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004521,0043571', uniprot = '', pdbid = '5xvp', asym_id = 'E'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004521,0043571', uniprot='', pdbid='5xvp', asym_id='E')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>