Structure of PDB 5xvo Chain E

Receptor sequence

>5xvoE (length=106) Species: 749498 (Enterococcus faecalis TX0027)

YRYMRLLLMFDMPTDTASDRKAYRKFRKFLINEGFIMHQFSVYSKILLND
TANKAMLARLKQNNPQRGLITLLNVTEKQFSRMIYLHGEQDNRVANSDER
IVFLGE

3D structure

• PDB: 5xvo How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.
• Chain: E
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	E	R26 K30 F42	R24 K28 F40
BS02	dna	E	D52 T78	D50 T76
BS03	dna	E	R4 F12 D13 M14 P15 T16 Y25 R29 M39 S43 Y45 N51 T53	R2 F10 D11 M12 P13 T14 Y23 R27 M37 S41 Y43 N49 T51
BS04	MG	E	F12 D13 S43	F10 D11 S41

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 02:41:47 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5xvo', asym_id = 'E', title = 'How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5xvo', asym_id='E', title='How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004521,0043571', uniprot = '', pdbid = '5xvo', asym_id = 'E'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004521,0043571', uniprot='', pdbid='5xvo', asym_id='E')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>