Structure of PDB 5xm0 Chain E

Receptor sequence
>5xm0E (length=97) Species: 10090 (Mus musculus) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSA
AIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB5xm0 Histone H3.3 sub-variant H3mm7 is required for normal skeletal muscle regeneration.
ChainE
Resolution2.874 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H39 R40 Y41 G44 V46 R49 R63 K64 L65 R69 R83 H2 R3 Y4 G7 V9 R12 R26 K27 L28 R32 R46
BS02 dna E Y41 R42 P43 T45 R63 R72 R83 F84 Q85 S86 R116 V117 T118 M120 Y4 R5 P6 T8 R26 R35 R46 F47 Q48 S49 R79 V80 T81 M83
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0001556 oocyte maturation
GO:0001649 osteoblast differentiation
GO:0006334 nucleosome assembly
GO:0006997 nucleus organization
GO:0007283 spermatogenesis
GO:0007286 spermatid development
GO:0007338 single fertilization
GO:0007566 embryo implantation
GO:0008283 cell population proliferation
GO:0008584 male gonad development
GO:0030307 positive regulation of cell growth
GO:0031508 pericentric heterochromatin formation
GO:0031509 subtelomeric heterochromatin formation
GO:0035264 multicellular organism growth
GO:0042692 muscle cell differentiation
GO:0048477 oogenesis
GO:0090230 regulation of centromere complex assembly
GO:1902340 negative regulation of chromosome condensation
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0000939 inner kinetochore
GO:0001740 Barr body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xm0, PDBe:5xm0, PDBj:5xm0
PDBsum5xm0
PubMed29643389
UniProtP84244|H33_MOUSE Histone H3.3 (Gene Name=H3-3a)

[Back to BioLiP]