Structure of PDB 5x8p Chain E

Receptor sequence

>5x8pE (length=210) Species: 3562 (Spinacia oleracea) [Search protein sequence]

LIPLPILNFSGEKVGETFLNLKTAPPEKARAVVHRGLITHLQNKRRGTAS
TLTRAEVRGGGRKPYPQKKTGRARRGSQGSPLRPGGGVIFGPKPRDWTIK
MNKKERRLALSTAIASAVGNSFVVEEFAENFEKPKTKDFIAAMQRWGLDP
AEKSLFFLMDLVENVEKSGRNIRTLKLLTPRSLNLFDVLNAEKLVFTEGT
IQYLNQRYGV

3D structure

PDB

5x8p Unique localization of the plastid-specific ribosomal proteins in the chloroplast ribosome small subunit provides mechanistic insights into the chloroplastic translation

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	K79 V83 H85 R86 I89 L92 N94 R96 R97 T99 S101 L103 R105 A106 V108 R109 G110 G111 R113 K114 Q118 K119 K120 T121 R123 A124 R125 L133 R134 P135 V139 I140 F141 P143 K151 N153 K154 K155 E156 R158 L159 K186 T187 K188 K204 K218 R221 N222 R224 R232 S233 N235 F237 R258	K28 V32 H34 R35 I38 L41 N43 R45 R46 T48 S50 L52 R54 A55 V57 R58 G59 G60 R62 K63 Q67 K68 K69 T70 R72 A73 R74 L82 R83 P84 V88 I89 F90 P92 K100 N102 K103 K104 E105 R107 L108 K135 T136 K137 K153 K167 R170 N171 R173 R181 S182 N184 F186 R207

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5x8p, PDBe:5x8p, PDBj:5x8p
PDBsum	5x8p
PubMed	28582576
UniProt	O49937\|RK4_SPIOL Large ribosomal subunit protein uL4c (Gene Name=RPL4)

[Back to BioLiP]