Structure of PDB 5v7q Chain E

Receptor sequence

>5v7qE (length=207) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]

LKIDVKTPAGKVDGAIELPAELFDVPANIALMHQVVTAQRAAARQGTHST
KTRGEVSGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVHGPKPRDYSQRT
PKKMIAAALRGALSDRARNGRIHAITELVEGQNPSTKSARAFLASLTERK
QVLVVIGRSDEAGAKSVRNLPGVHILAPDQLNTYDVLRADDVVFSVEALN
AYIAANT

3D structure

PDB

5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.

Chain

Resolution

3.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	N36 H41 Q42 Q47 R48 A51 R52 Q53 T55 H56 S57 K59 R61 G62 G66 R69 K70 G78 R79 R81 G83 R86 Q89 F90 T91 G92 V95 H97 K100 R102 Q106 R107 P109 K110 M112 I113 T144 K145 R148 K173 N177 P179 I183 Q188 Y192 D193 R196	N28 H33 Q34 Q39 R40 A43 R44 Q45 T47 H48 S49 K51 R53 G54 G58 R61 K62 G70 R71 R73 G75 R78 Q81 F82 T83 G84 V87 H89 K92 R94 Q98 R99 P101 K102 M104 I105 T136 K137 R140 K165 N169 P171 I175 Q180 Y184 D185 R188

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005886	plasma membrane
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
PDBsum	5v7q
PubMed	28977617
UniProt	P9WH85\|RL4_MYCTU Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]