Structure of PDB 5uie Chain E

Receptor sequence

>5uieE (length=308) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AILSEKPNVKWEDVAGLEGAKEALKEAVILPVKFPHLFKGNRKPTSGILL
YGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESEKLVKQLFAMA
RENKPSIIFIDEVDALTGTRGEGESEASRRIKTELLVQMNGVGNDSQGVL
VLGATNIPWQLDSAIRRRFERRIYIPLPDLAARTTMFEINVGDTPCVLTK
EDYRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSATHFKDVSETRKLTP
CSPGDDGAIEMSWTDIEADELKEPDLTIKDFLKAIKSTRPTVNEDDLLKQ
EQFTRDFG

3D structure

PDB

5uie Structural basis of protein translocation by the Vps4-Vta1 AAA ATPase.

Chain

Resolution

5.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	E	V135 A136 G176 T177 G178 K179 S180 Y181 M307 G336	V14 A15 G55 T56 G57 K58 S59 Y60 M186 G215

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0016887	ATP hydrolysis activity
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity

	Biological Process
GO:0001778	plasma membrane repair
GO:0006914	autophagy
GO:0006997	nucleus organization
GO:0007033	vacuole organization
GO:0015031	protein transport
GO:0016125	sterol metabolic process
GO:0016197	endosomal transport
GO:0016236	macroautophagy
GO:0031468	nuclear membrane reassembly
GO:0032511	late endosome to vacuole transport via multivesicular body sorting pathway
GO:0036258	multivesicular body assembly
GO:0045053	protein retention in Golgi apparatus
GO:0045324	late endosome to vacuole transport
GO:0061709	reticulophagy
GO:0061764	late endosome to lysosome transport via multivesicular body sorting pathway
GO:0061952	midbody abscission
GO:0070676	intralumenal vesicle formation
GO:0071985	multivesicular body sorting pathway
GO:0090148	membrane fission
GO:0097352	autophagosome maturation

	Cellular Component
GO:0005643	nuclear pore
GO:0005737	cytoplasm
GO:0005768	endosome
GO:0005783	endoplasmic reticulum
GO:0005886	plasma membrane
GO:0010008	endosome membrane
GO:0016020	membrane
GO:0030496	midbody
GO:1904949	ATPase complex
GO:1990621	ESCRT IV complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5uie, PDBe:5uie, PDBj:5uie
PDBsum	5uie
PubMed	28379137
UniProt	P52917\|VPS4_YEAST Vacuolar protein sorting-associated protein 4 (Gene Name=VPS4)

[Back to BioLiP]