Structure of PDB 5tc1 Chain E |
>5tc1E (length=129) Species: 329852 (Emesvirus zinderi) [Search protein sequence] |
ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQ SSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSD CELIVKAMQGLLKDGNPIPSAIAANSGIY |
|
PDB | 5tc1 In situ structures of the genome and genome-delivery apparatus in a single-stranded RNA virus. |
Chain | E |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
E |
F25 N27 S51 |
F25 N27 S51 |
|
|
|
|