Structure of PDB 5nnu Chain E

Receptor sequence

>5nnuE (length=222) Species: 37296 (Human gammaherpesvirus 8)

DLLLAPKWISFLSLSSFLKQKLLSLLRQIRELRLTTTVYPPQDKLMWWSH
CCDPEDIKVVILGQDPYHKGQATGLAFSVDPQCQVPPSLRSIFRELEASV
PNFSTPSHGCLDSWARQGVLLLNTVLTVEKGGWDWFTSFIISSISSKLEH
CVFLLWGRKAIDRTPLINAQKHLVLTAQHPSPLASLGGRHSRWPRFQGCN
HFNLANDYLTRHRRETVDWGLL

3D structure

• PDB: 5nnu A structurally conserved motif in gamma-herpesvirus uracil-DNA glycosylases elicits duplex nucleotide-flipping.
• Chain: E
• Resolution: 2.97 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D91 Y93 F103 H213
• Catalytic site (residue number reindexed from 1): D65 Y67 F77 H179
• Enzyme Commision number: 3.2.2.27: uracil-DNA glycosylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	E	S39 F173 S180 K181	S13 F139 S146 K147
BS02	dna	E	D91 P113 S114 G191 R192 Q212 H213 S215 P216 L217 A218 G221 G222 S225	D65 P87 S88 G157 R158 Q178 H179 S181 P182 L183 A184 G187 G188 S191
BS03	dna	E	R116 S219 L220 R223	R90 S185 L186 R189

Gene Ontology

Molecular Function

• GO:0004844 uracil DNA N-glycosylase activity
• GO:0016787 hydrolase activity
• GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair
• GO:0097510 base-excision repair, AP site formation via deaminated base removal

Cellular Component

• GO:0042025 host cell nucleus

External links

• PDB: RCSB:5nnu, PDBe:5nnu, PDBj:5nnu
• PDBsum: 5nnu
• PubMed: 29596604
• UniProt: F5HFA1|UNG_HHV8P Uracil-DNA glycosylase (Gene Name=ORF46)