Structure of PDB 5m3k Chain E |
>5m3kE (length=145) Species: 220664 (Pseudomonas protegens Pf-5) [Search protein sequence] |
SMYPEQIHRMTTASMLREWREHGGKYRLEGSQCEECNEIFFPRRTVCGAC NSLSVKPYRCARSGKIEVMAPAENPILAAMGYGETVPRIMAMVRLDDGLV IASEIVDVCDQQQLKVGAPVRMVIRKHVRESNLAWQYAYKFVLDI |
|
PDB | 5m3k Structure and Catalytic Mechanism of a Bacterial Friedel-Crafts Acylase. |
Chain | E |
Resolution | 2.83 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
E |
C34 C37 C48 C51 |
C33 C36 C47 C50 |
|
|
|
|