Structure of PDB 5lm7 Chain E

Receptor sequence

>5lm7E (length=91) Species: 585035 (Escherichia coli S88) [Search protein sequence]

QNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTV
LIDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQIS

3D structure

PDB

5lm7 Structural basis for lambda N-dependent processive transcription antitermination.

Chain

Resolution

3.35 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	D14 H15	D13 H14

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0001072	transcription antitermination factor activity, RNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0031564	transcription antitermination
GO:0032784	regulation of DNA-templated transcription elongation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0008023	transcription elongation factor complex
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5lm7, PDBe:5lm7, PDBj:5lm7
PDBsum	5lm7
PubMed	28452979
UniProt	P0A7R5\|RS10_ECOLI Small ribosomal subunit protein uS10 (Gene Name=rpsJ)