Structure of PDB 5l2l Chain E

Receptor sequence

>5l2lE (length=72) Species: 1294386 (Saccharomyces cerevisiae YJM1574) [Search protein sequence]

EKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDC
RFGVNCKNIYCLFRHPPGRVLP

3D structure

PDB

5l2l Structural basis for the dimerization of Nab2 generated by RNA binding provides insight into its contribution to both poly(A) tail length determination and transcript compaction in Saccharomyces cerevisiae.

Chain

Resolution

1.55 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	E	E413 C415 N423 R425 Y428	E5 C7 N15 R17 Y20
BS02	rna	E	T419 R432 I435 C437 R438 R445 L449 F450	T11 R24 I27 C29 R30 R37 L41 F42
BS03	rna	E	K416 F417 C421 T422 E456 C458 R459 F460 F471	K8 F9 C13 T14 E48 C50 R51 F52 F63
BS04	ZN	E	C415 C421 C426 H430	C7 C13 C18 H22
BS05	ZN	E	C437 C443 C448 H452	C29 C35 C40 H44
BS06	ZN	E	C458 C464 C469 H473	C50 C56 C61 H65

External links

PDB	RCSB:5l2l, PDBe:5l2l, PDBj:5l2l
PDBsum	5l2l
PubMed	28180315
UniProt	P32505\|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 (Gene Name=NAB2)

[Back to BioLiP]