Structure of PDB 5kgf Chain E

Receptor sequence
>5kgfE (length=100) Species: 8355 (Xenopus laevis) [Search protein sequence]
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQ
SSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB5kgf The structural basis of modified nucleosome recognition by 53BP1.
ChainE
Resolution4.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R40 Y41 G44 T45 V46 R49 R63 K64 L65 P66 R69 R5 Y6 G9 T10 V11 R14 R28 K29 L30 P31 R34
BS02 dna E H39 Y41 R42 R63 R72 R83 F84 Q85 R116 V117 T118 M120 H4 Y6 R7 R28 R37 R48 F49 Q50 R81 V82 T83 M85
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5kgf, PDBe:5kgf, PDBj:5kgf
PDBsum5kgf
PubMed27462807
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]