Structure of PDB 5jvg Chain E

Receptor sequence
>5jvgE (length=171) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]
GKQPIAVPSGVTVNAQDGVFKVKGPKGELTVPYNTELTVRQDGDQLLVER
PSDAQKHRALHGLTRTLVANAVKGVSDGYTINLELRGVGFRAKLTGKALE
MNIGYSHPVIIEPPAGVTFAVPEPTRIDVSGIDKQLVGQVAANVRKVRKP
DAYHGKGVRFVGEQIALKAGK
3D structure
PDB5jvg Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
ChainE
Resolution3.428 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna E G5 Q59 R62 A63 G66 L67 T70 G108 S110 H111 K138 Q139 G142 Q143 K150 K153 Y157 H158 K160 K172 K175 G1 Q55 R58 A59 G62 L63 T66 G104 S106 H107 K134 Q135 G138 Q139 K146 K149 Y153 H154 K156 K168 K171
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jvg, PDBe:5jvg, PDBj:5jvg
PDBsum5jvg
PubMed27791159
UniProtQ9RSL3|RL6_DEIRA Large ribosomal subunit protein uL6 (Gene Name=rplF)

[Back to BioLiP]