Structure of PDB 5jup Chain E

Receptor sequence
>5jupE (length=171) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVSICIFGDAFDVDRA
KSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQVPRLLGPQ
LSKAGKFPTPVSHNDDLYGKVTDVRVEMEEDVLVNQILMSVNFFVSLLKK
NWQNVGSLVVKSSMGPAFRLY
3D structure
PDB5jup Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.
ChainE
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna E R26 N27 F28 E33 K97 K98 K101 K102 K105 K106 K130 A131 F190 V205 K207 S209 R26 N27 F28 E33 K70 K71 K74 K75 K78 K79 K103 A104 F144 V159 K161 S163
BS02 rna E I117 P121 S129 G132 F134 I90 P94 S102 G105 F107
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000055 ribosomal large subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jup, PDBe:5jup, PDBj:5jup
PDBsum5jup
PubMed27159452
UniProtP0CX43|RL1A_YEAST Large ribosomal subunit protein uL1A (Gene Name=RPL1A)

[Back to BioLiP]