Structure of PDB 5jm1 Chain E

Receptor sequence

>5jm1E (length=133) Species: 3490 (Artocarpus integer)

GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL

3D structure

• PDB: 5jm1 Effect of linkage on the location of reducing and nonreducing sugars bound to jacalin.
• Chain: E
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	T10 F60 P61 Y64 L112 L133	T10 F60 P61 Y64 L112 L133
BS02	peptide	E	F104 D125 Y126 F127 S128 M129 Y130 L131	F104 D125 Y126 F127 S128 M129 Y130 L131
BS03	peptide	E	N105 P107 I108 E109 N110 L133	N105 P107 I108 E109 N110 L133
BS04	GAL	E	S76 Y122	S76 Y122
BS05	GAL	E	Y78 Y122	Y78 Y122
BS06	GLA	E	G1 G121 Y122 W123 D125	G1 G121 Y122 W123 D125

Gene Ontology

Molecular Function

• GO:0019862 IgA binding
• GO:0030246 carbohydrate binding

Biological Process

• GO:0008150 biological_process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:5jm1, PDBe:5jm1, PDBj:5jm1
• PDBsum: 5jm1
• PubMed: 27808459
• UniProt: P18670|LECA_ARTIN Agglutinin alpha chain