Structure of PDB 5jco Chain E

Receptor sequence
>5jcoE (length=428) Species: 9606 (Homo sapiens) [Search protein sequence]
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPDSFNTFFSETGAG
KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT
IGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSV
DYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAI
YDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNL
VPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRH
GKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQP
PTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYV
GEGMEEGEFSEAREDMAALEKDYEEVGV
3D structure
PDB5jco Structure and Dynamics of Single-isoform Recombinant Neuronal Human Tubulin.
ChainE
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.-
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 GTP E G10 Q11 A12 D98 N101 S140 G143 T145 G146 N206 Y224 N228 G10 Q11 A12 D89 N92 S131 G134 T136 G137 N197 Y215 N219
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
GO:0005200 structural constituent of cytoskeleton
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000226 microtubule cytoskeleton organization
GO:0000278 mitotic cell cycle
GO:0001764 neuron migration
GO:0001964 startle response
GO:0006886 intracellular protein transport
GO:0007017 microtubule-based process
GO:0007098 centrosome cycle
GO:0007224 smoothened signaling pathway
GO:0007613 memory
GO:0007626 locomotory behavior
GO:0008344 adult locomotory behavior
GO:0008542 visual learning
GO:0009612 response to mechanical stimulus
GO:0010001 glial cell differentiation
GO:0010467 gene expression
GO:0021542 dentate gyrus development
GO:0021696 cerebellar cortex morphogenesis
GO:0021766 hippocampus development
GO:0021859 pyramidal neuron differentiation
GO:0021987 cerebral cortex development
GO:0022008 neurogenesis
GO:0030182 neuron differentiation
GO:0030317 flagellated sperm motility
GO:0030534 adult behavior
GO:0030705 cytoskeleton-dependent intracellular transport
GO:0034612 response to tumor necrosis factor
GO:0035641 locomotory exploration behavior
GO:0046785 microtubule polymerization
GO:0048853 forebrain morphogenesis
GO:0048873 homeostasis of number of cells within a tissue
GO:0050807 regulation of synapse organization
GO:0050808 synapse organization
GO:0051301 cell division
GO:0051402 neuron apoptotic process
GO:0061744 motor behavior
GO:0071277 cellular response to calcium ion
GO:0072384 organelle transport along microtubule
GO:0140058 neuron projection arborization
GO:1902065 response to L-glutamate
Cellular Component
GO:0000793 condensed chromosome
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005879 axonemal microtubule
GO:0005881 cytoplasmic microtubule
GO:0005886 plasma membrane
GO:0015630 microtubule cytoskeleton
GO:0031514 motile cilium
GO:0031594 neuromuscular junction
GO:0036126 sperm flagellum
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0045202 synapse
GO:0055037 recycling endosome
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5jco, PDBe:5jco, PDBj:5jco
PDBsum5jco
PubMed27129203
UniProtQ71U36|TBA1A_HUMAN Tubulin alpha-1A chain (Gene Name=TUBA1A)

[Back to BioLiP]