Structure of PDB 5jbh Chain E

Receptor sequence

>5jbhE (length=241) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]

RKGPKRHLKRLAAPTSWYIERKAYKWAVRPRPGPHNMRTSIPLLYIVRDY
LGYAKTAREARKILNEGKFLVDGRVRKDYKFPVGIMDVVSIPETGEHYRV
LPNRIGKLILHPISEDEAFIKPLRIRNKRMIKGARVQLNFHDGTNHIVSI
AEKDNYFTSYTVLMKVPEREILEVLPFEKGAYVFVTQGKNVARKGRIVEI
KRFPMGWPDVVTIEDEEGELFDTLKEYAFVVGTDKPKISLP

3D structure

PDB

5jbh Cryo-EM study of start codon selection during archaeal translation initiation.

Chain

Resolution

5.34 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	R3 K4 G5 P6 K7 R8 H9 K11 R12 L13 R23 K24 Y26 W28 A29 V30 P34 G35 P36 N38 M39 R50 T58 R60 N67 R76 K82 I107 K109 R128 K130 R131 M132 I133 K134 T146 N147 E154 K155 F159 R171 K191 N192 F205 P206 M207 G208 W209 P210 D224 Y229	R1 K2 G3 P4 K5 R6 H7 K9 R10 L11 R21 K22 Y24 W26 A27 V28 P32 G33 P34 N36 M37 R48 T56 R58 N65 R74 K80 I105 K107 R126 K128 R129 M130 I131 K132 T144 N145 E152 K153 F157 R169 K189 N190 F203 P204 M205 G206 W207 P208 D222 Y227

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5jbh, PDBe:5jbh, PDBj:5jbh
PDBsum	5jbh
PubMed	27819266
UniProt	Q8U011\|RS4E_PYRFU Small ribosomal subunit protein eS4 (Gene Name=rps4e)

[Back to BioLiP]