Structure of PDB 5j50 Chain E

Receptor sequence
>5j50E (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence]
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
3D structure
PDB5j50 Structure of tetrameric jacalin complexed with Gal beta-(1,3) GalNAc-alpha-OPNP
ChainE
Resolution2.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide E T10 P61 L112 S132 L133 T10 P61 L112 S132 L133
BS02 peptide E V79 F104 D125 Y126 F127 S128 M129 Y130 L131 V79 F104 D125 Y126 F127 S128 M129 Y130 L131
BS03 peptide E N105 P107 I108 E109 N110 L133 N105 P107 I108 E109 N110 L133
BS04 NPO E S76 Y78 Y122 S76 Y78 Y122
Gene Ontology
Molecular Function
GO:0019862 IgA binding
GO:0030246 carbohydrate binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j50, PDBe:5j50, PDBj:5j50
PDBsum5j50
PubMed
UniProtP18670|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]