Structure of PDB 5hbu Chain E

Receptor sequence
>5hbuE (length=190) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RNRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRM
FDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRI
LTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLL
ASQILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ
3D structure
PDB5hbu Structures of the nucleoid occlusion protein SlmA bound to DNA and the C-terminal domain of the cytoskeletal protein FtsZ.
ChainE
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R31 T33 T34 E45 Y49 S54 K55 R23 T25 T26 E37 Y41 S46 K47
BS02 dna E V43 S44 A46 R50 V35 S36 A38 R42
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0000918 division septum site selection
GO:0006355 regulation of DNA-templated transcription
GO:0010974 negative regulation of division septum assembly
GO:0032272 negative regulation of protein polymerization
GO:0051301 cell division
GO:0051302 regulation of cell division
Cellular Component
GO:0005737 cytoplasm
GO:0009295 nucleoid
GO:0043590 bacterial nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hbu, PDBe:5hbu, PDBj:5hbu
PDBsum5hbu
PubMed27091999
UniProtP0C093|SLMA_ECOLI Nucleoid occlusion factor SlmA (Gene Name=slmA)

[Back to BioLiP]