Structure of PDB 5h8y Chain E

Receptor sequence

>5h8yE (length=96) Species: 4577 (Zea mays)

ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGK
VVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELT

3D structure

• PDB: 5h8y Structural and mutational studies of an electron transfer complex of maize sulfite reductase and ferredoxin.
• Chain: E
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	E	Y37 C39 R40 G42 C44 C47 C77	Y37 C39 R40 G42 C44 C47 C77

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0022900 electron transport chain

External links

• PDB: RCSB:5h8y, PDBe:5h8y, PDBj:5h8y
• PDBsum: 5h8y
• PubMed: 26920048
• UniProt: P27787|FER1_MAIZE Ferredoxin-1, chloroplastic (Gene Name=FDX1)