Structure of PDB 5exk Chain E

Receptor sequence

>5exkE (length=302) Species: 83332 (Mycobacterium tuberculosis H37Rv)

AAEGRRLLRLEVRNAQTPIERKPPWIKTRARIGPEYTELKNLVRREGLHT
VCEEAGCPNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPAELDRDEP
RRVADSVRTMGLRYATVTGVARDDLPDGGAWLYAATVRAIKELNPSTGVE
LLIPDFNGEPTRLAEVFESGPEVLAHNVETVPRIFKRIRPAFTYRRSLGV
LTAARDAGLVTKSNLILGLGETSDEVRTALGDLRDAGCDIVTITQYLRPS
ARHHPVERWVKPEEFVQFARFAEGLGFAGVLAGPLVRSSYRAGRLYEQAR
NS

3D structure

• PDB: 5exk Crystallographic snapshots of sulfur insertion by lipoyl synthase.
• Chain: E
• Resolution: 1.86 Å

Enzymatic activity

• Enzyme Commision number: 2.8.1.8: lipoyl synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	K25 P26 I29 V54 C55 A58 G59 C60 P61 L250 R290 S292	K22 P23 I26 V51 C52 A55 G56 C57 P58 L247 R287 S289
BS02	F3S	E	C55 C60 N62 I63 C66 Y293	C52 C57 N59 I60 C63 Y290
BS03	SF4	E	C81 R83 C85 F87 C88 R192 F195	C78 R80 C82 F84 C85 R189 F192
BS04	MET	E	T121 G122 P157 R192 F195	T118 G119 P154 R189 F192

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016740 transferase activity
• GO:0016992 lipoate synthase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009107 lipoate biosynthetic process
• GO:0009249 protein lipoylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5exk, PDBe:5exk, PDBj:5exk
• PDBsum: 5exk
• PubMed: 27506792
• UniProt: P9WK91|LIPA_MYCTU Lipoyl synthase (Gene Name=lipA)