Structure of PDB 5elf Chain E

Receptor sequence

>5elfE (length=103) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961)

TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQV
EVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAIS
MAN

3D structure

• PDB: 5elf High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
• Chain: E
• Resolution: 1.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLC	E	G45 I47	G45 I47	PDBbind-CN: -logKd/Ki=2.34,Kd=4.57mM
BS02	GAL	E	Y18 H94	Y18 H94	PDBbind-CN: -logKd/Ki=2.34,Kd=4.57mM
BS03	FUC	E	A46 I47 F48 P93 H94	A46 I47 F48 P93 H94	PDBbind-CN: -logKd/Ki=2.34,Kd=4.57mM

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005534 galactose binding
• GO:0046812 host cell surface binding
• GO:0090729 toxin activity

Biological Process

• GO:0035821 modulation of process of another organism
• GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein

Cellular Component

• GO:0005576 extracellular region
• GO:0016020 membrane
• GO:0020002 host cell plasma membrane
• GO:0042597 periplasmic space
• GO:1902494 catalytic complex

External links

• PDB: RCSB:5elf, PDBe:5elf, PDBj:5elf
• PDBsum: 5elf
• PubMed: 27082955
• UniProt: P01556|CHTB_VIBCH Cholera enterotoxin subunit B (Gene Name=ctxB)