Structure of PDB 5eh2 Chain E

Receptor sequence

>5eh2E (length=110) Species: 9606 (Homo sapiens)

KPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQ
RTHTGEKPYVCRECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKS
HLLRHQRTHT

3D structure

• PDB: 5eh2 Structural basis for human PRDM9 action at recombination hot spots.
• Chain: E
• Resolution: 2.05 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-
  2.1.1.354: [histone H3]-lysine(4) N-trimethyltransferase.
  2.1.1.355: [histone H3]-lysine(9) N-trimethyltransferase.
  2.1.1.359: [histone H3]-lysine(36) N-trimethyltransferase.
  2.1.1.361: [histone H4]-lysine(20) N-methyltransferase.
  2.1.1.362: [histone H4]-N-methyl-L-lysine(20) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	E	R726 H733 R736 T740 F756 H761 R764 H765 T768 R782 R785 N789 H793 R810 F812 N814 H817 R820 H821	R10 H17 R20 T24 F40 H45 R48 H49 T52 R66 R69 N73 H77 R94 F96 N98 H101 R104 H105	PDBbind-CN: Kd=28nM
BS02	dna	E	Y719 K731 S732 K759 S760 Y775 K787 S788 K815 S816 L819 R823	Y3 K15 S16 K43 S44 Y59 K71 S72 K99 S100 L103 R107	PDBbind-CN: Kd=28nM
BS03	ZN	E	C721 C724 H737 H741	C5 C8 H21 H25
BS04	ZN	E	C749 C752 H765 H769	C33 C36 H49 H53
BS05	ZN	E	C777 C780 H793 H797	C61 C64 H77 H81
BS06	ZN	E	C805 C808 H821 H825	C89 C92 H105 H109

External links

• PDB: RCSB:5eh2, PDBe:5eh2, PDBj:5eh2
• PDBsum: 5eh2
• PubMed: 26833727
• UniProt: Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 (Gene Name=PRDM9)