Structure of PDB 5dqu Chain E |
>5dquE (length=93) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
MSMLVVVTENVPPRLRGRLAIWLLEVRAGVYVGDVSAKIREMIWEQIAGL AEEGNVVMAWATNTETGFEFQTFGLNRRTPVDLDGLRLVSFLP |
|
PDB | 5dqu Structural and Mechanistic Basis of PAM-Dependent Spacer Acquisition in CRISPR-Cas Systems. |
Chain | E |
Resolution | 4.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
E |
R77 R78 F91 |
R77 R78 F91 |
|
|
|
|