Structure of PDB 5dj4 Chain E

Receptor sequence
>5dj4E (length=365) Species: 9606 (Homo sapiens) [Search protein sequence]
GLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYI
AIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKL
LAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCG
ILPEGDPPSEQSSPRDVEALMERMQQLQEEEMESRFELEKSESLPDMLCF
VEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDE
KFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQ
LLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQ
AALLYALRAITRYMT
3D structure
PDB5dj4 Structural basis for leucine sensing by the Sestrin2-mTORC1 pathway.
ChainE
Resolution2.697 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.11.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 LEU E T374 Y375 T377 T386 E451 T259 Y260 T262 T271 E336
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005092 GDP-dissociation inhibitor activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor
GO:0032542 sulfiredoxin activity
GO:0042731 PH domain binding
GO:0044877 protein-containing complex binding
GO:0070728 L-leucine binding
GO:0140311 protein sequestering activity
Biological Process
GO:0001932 regulation of protein phosphorylation
GO:0006111 regulation of gluconeogenesis
GO:0006635 fatty acid beta-oxidation
GO:0007005 mitochondrion organization
GO:0009749 response to glucose
GO:0016239 positive regulation of macroautophagy
GO:0030308 negative regulation of cell growth
GO:0030330 DNA damage response, signal transduction by p53 class mediator
GO:0032042 mitochondrial DNA metabolic process
GO:0032868 response to insulin
GO:0034198 cellular response to amino acid starvation
GO:0034599 cellular response to oxidative stress
GO:0042149 cellular response to glucose starvation
GO:0042593 glucose homeostasis
GO:0046323 D-glucose import
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0070328 triglyceride homeostasis
GO:0071230 cellular response to amino acid stimulus
GO:0071233 cellular response to L-leucine
GO:0072593 reactive oxygen species metabolic process
GO:0098869 cellular oxidant detoxification
GO:1900182 positive regulation of protein localization to nucleus
GO:1901031 regulation of response to reactive oxygen species
GO:1902010 negative regulation of translation in response to endoplasmic reticulum stress
GO:1903432 regulation of TORC1 signaling
GO:1904262 negative regulation of TORC1 signaling
GO:1904263 positive regulation of TORC1 signaling
GO:1904504 positive regulation of lipophagy
GO:1990253 cellular response to leucine starvation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005765 lysosomal membrane
GO:0005829 cytosol
GO:0031588 nucleotide-activated protein kinase complex
GO:0031932 TORC2 complex
GO:1990316 Atg1/ULK1 kinase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dj4, PDBe:5dj4, PDBj:5dj4
PDBsum5dj4
PubMed26586190
UniProtP58004|SESN2_HUMAN Sestrin-2 (Gene Name=SESN2)

[Back to BioLiP]