Structure of PDB 4zux Chain E

Receptor sequence
>4zuxE (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB4zux Structural basis for histone H2B deubiquitination by the SAGA DUB module.
ChainE
Resolution3.82 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna E H39 R40 Y41 G44 T45 V46 A47 R49 R63 K64 L65 P66 R69 R83 H1 R2 Y3 G6 T7 V8 A9 R11 R25 K26 L27 P28 R31 R45
BS02 dna E R40 Y41 R42 T45 R72 R83 F84 R116 V117 T118 R2 Y3 R4 T7 R34 R45 F46 R78 V79 T80
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:4zux, PDBe:4zux, PDBj:4zux
PDBsum4zux
PubMed26912860
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]