Structure of PDB 4z8l Chain E |
>4z8lE (length=79) Species: 11723 (Simian immunodeficiency virus) [Search protein sequence] |
EAPEGAGEVGLEQWLETSLERINREARLHFHPEFLFRLWNTCVEHWHDRH QRSLDYAKYRYLLLMHKAMYTHMQQGCPC |
|
PDB | 4z8l Structural Basis of Clade-specific Engagement of SAMHD1 (Sterile alpha Motif and Histidine/Aspartate-containing Protein 1) Restriction Factors by Lentiviral Viral Protein X (Vpx) Virulence Factors. |
Chain | E |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
E |
H38 H81 C86 |
H29 H72 C77 |
|
|
|
|