Structure of PDB 4xob Chain E

Receptor sequence

>4xobE (length=279) Species: 83333 (Escherichia coli K-12)

FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPE
TITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTD
KPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYA
NNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGT
TADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSL
GLTANYARTGGQVTAGNVQSIIGVTFVYQ

3D structure

• PDB: 4xob Catch-bond mechanism of the bacterial adhesin FimH.
• Chain: E
• Resolution: 3.003 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	A115 A165 R166 D167 V168 T169 V170 T171 L172 D174 Y175 Y256 T264 A265 G266 N267 V268 Q269 S270 I271 I272 G273 V274 T275 F276	A115 A165 R166 D167 V168 T169 V170 T171 L172 D174 Y175 Y256 T264 A265 G266 N267 V268 Q269 S270 I271 I272 G273 V274 T275 F276
BS02	KGM	E	F1 I13 N46 I52 D54 N135 Y137 D140	F1 I13 N46 I52 D54 N135 Y137 D140

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005537 D-mannose binding

Biological Process

• GO:0007155 cell adhesion
• GO:0007638 mechanosensory behavior
• GO:0031589 cell-substrate adhesion
• GO:0043709 cell adhesion involved in single-species biofilm formation

Cellular Component

• GO:0009289 pilus
• GO:0009419 pilus tip
• GO:0033644 host cell membrane

External links

• PDB: RCSB:4xob, PDBe:4xob, PDBj:4xob
• PDBsum: 4xob
• PubMed: 26948702
• UniProt: P08191|FIMH_ECOLI Type 1 fimbrin D-mannose specific adhesin (Gene Name=fimH)