Structure of PDB 4wnc Chain E

Receptor sequence
>4wncE (length=333) Species: 9606 (Homo sapiens) [Search protein sequence]
KVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDST
HGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVF
TTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASC
TTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGA
LQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKP
AKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIA
LNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
3D structure
PDB4wnc A Dimer Interface Mutation in Glyceraldehyde-3-Phosphate Dehydrogenase Regulates Its Binding to AU-rich RNA.
ChainE
Resolution1.99 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C152 H179
Catalytic site (residue number reindexed from 1) C150 H177
Enzyme Commision number 1.2.1.12: glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
2.6.99.-
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN E E106 D127 E104 D125
BS02 NAD E F11 G12 R13 I14 D35 P36 F37 T99 F102 S122 C152 N316 Y320 F9 G10 R11 I12 D33 P34 F35 T97 F100 S120 C150 N314 Y318
Gene Ontology
Molecular Function
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0016740 transferase activity
GO:0019828 aspartic-type endopeptidase inhibitor activity
GO:0035605 peptidyl-cysteine S-nitrosylase activity
GO:0042802 identical protein binding
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0000226 microtubule cytoskeleton organization
GO:0001819 positive regulation of cytokine production
GO:0006006 glucose metabolic process
GO:0006096 glycolytic process
GO:0006417 regulation of translation
GO:0006915 apoptotic process
GO:0010951 negative regulation of endopeptidase activity
GO:0016241 regulation of macroautophagy
GO:0017148 negative regulation of translation
GO:0031640 killing of cells of another organism
GO:0032481 positive regulation of type I interferon production
GO:0035606 peptidyl-cysteine S-trans-nitrosylation
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0045087 innate immune response
GO:0050821 protein stabilization
GO:0050832 defense response to fungus
GO:0051402 neuron apoptotic process
GO:0051873 killing by host of symbiont cells
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0071346 cellular response to type II interferon
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005811 lipid droplet
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0031965 nuclear membrane
GO:0031982 vesicle
GO:0043231 intracellular membrane-bounded organelle
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0097452 GAIT complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4wnc, PDBe:4wnc, PDBj:4wnc
PDBsum4wnc
PubMed25451934
UniProtP04406|G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase (Gene Name=GAPDH)

[Back to BioLiP]