Structure of PDB 4w4u Chain E |
>4w4uE (length=84) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
RSGDAEIKGIKPKVIEEYDSWKSLMSSAKDTPLQYDHMNRESLKKAFNPN AQLIEDPLDKPIQYRVCEKCGKPLALTAIVDHLE |
|
PDB | 4w4u Uncovering the role of Sgf73 in maintaining SAGA deubiquitinating module structure and activity. |
Chain | E |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
E |
C78 C81 H93 |
C67 C70 H82 |
|
|
|