Structure of PDB 4v4j Chain E

Receptor sequence

>4v4jE (length=180) Species: 262724 (Thermus thermophilus HB27)

LDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARI
LEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIF
LEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDAL
RGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4v4j Interactions and dynamics of the Shine Dalgarno helix in the 70S ribosome.
• Chain: E
• Resolution: 3.83 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	V38 N40 G42 K81 I88 S124 F125 D126 N130 Y131 N132 L133 G134 R136 R153 G154 M155 D156	V36 N38 G40 K79 I86 S122 F123 D124 N128 Y129 N130 L131 G132 R134 R151 G152 M153 D154
BS02	rna	E	W29 E30 Q66 K67 P68 A69 V70 T93 R95 R98	W27 E28 Q64 K65 P66 A67 V68 T91 R93 R96
BS03	rna	E	I77 S78 N79	I75 S76 N77

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4j, PDBe:4v4j, PDBj:4v4j
• PDBsum: 4v4j
• PubMed: 17940016
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)