Structure of PDB 4umm Chain E

Receptor sequence
>4ummE (length=87) Species: 7102 (Heliothis virescens) [Search protein sequence]
RQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACE
MDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKR
3D structure
PDB4umm The Palindromic DNA-Bound Usp-Ecr Nuclear Receptor Adopts an Asymmetric Organization with Allosteric Domain Positioning.
ChainE
Resolution11.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E G166 R173 R196 R197 Q200 R203 C223 G26 R33 R56 R57 Q60 R63 C83
BS02 dna E Y157 H158 Y159 K168 R172 K198 V218 R227 Y17 H18 Y19 K28 R32 K58 V78 R87
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4umm, PDBe:4umm, PDBj:4umm
PDBsum4umm
PubMed24942373
UniProtO18473|ECR_HELVI Ecdysone receptor (Gene Name=EcR)

[Back to BioLiP]