Structure of PDB 4ub6 Chain E

Receptor sequence

>4ub6E (length=81) Species: 32053 (Thermostichus vulcanus)

TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPD
SYYAQEQRSIPLVTDRFEAKQQVETFLEQLK

3D structure

• PDB: 4ub6 Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.
• Chain: E
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	E	F10 R18 Y19 H23 T26 L30	F7 R15 Y16 H20 T23 L27

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0005737 cytoplasm
• GO:0009523 photosystem II
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4ub6, PDBe:4ub6, PDBj:4ub6
• PDBsum: 4ub6
• PubMed: 25470056
• UniProt: P12238|PSBE_THEVL Cytochrome b559 subunit alpha (Gene Name=psbE)