Structure of PDB 4tnj Chain E

Receptor sequence

>4tnjE (length=82) Species: 197221 (Thermosynechococcus vestitus BP-1)

GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRP
DSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK

3D structure

• PDB: 4tnj Taking snapshots of photosynthetic water oxidation using femtosecond X-ray diffraction and spectroscopy.
• Chain: E
• Resolution: 4.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	I22 A33 L42	I20 A31 L40
BS02	HEM	E	R18 Y19 H23 T26 I27 L30	R16 Y17 H21 T24 I25 L28

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0005737 cytoplasm
• GO:0009523 photosystem II
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4tnj, PDBe:4tnj, PDBj:4tnj
• PDBsum: 4tnj
• PubMed: 25006873
• UniProt: Q8DIP0|PSBE_THEVB Cytochrome b559 subunit alpha (Gene Name=psbE)